Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR2J2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR2J2.

Rabbit Polyclonal Anti-OR2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT

Rabbit Polyclonal Anti-OR2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: VMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRL