Rabbit polyclonal anti-OR2A42 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2A42. |
Rabbit polyclonal anti-OR2A42 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2A42. |
Rabbit Polyclonal Anti-OR2A42 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR2A42 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A42. Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL |