Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the C terminal of human TAAR5. Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the middle region of human TAAR5. Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA