Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR4A15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A15.

OR4A15 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 277-306 amino acids from the C-terminal region of Human Olfactory receptor 4A15

Rabbit Polyclonal Anti-OR4A15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4A15 antibody is: synthetic peptide directed towards the N-terminal region of Human OR4A15. Synthetic peptide located within the following region: KNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGNLLIIVTIMASQSL