Primary Antibodies

View as table Download

Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

Band 3 / AE1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC4A1 / Band 3 / AE1 antibody was raised against synthetic peptide from human SLC4A1 / Band 3.

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC4A1 antibody: synthetic peptide directed towards the N terminal of human SLC4A1. Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR

Mouse monoclonal Anti-Band III Clone Q1/156

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC4A1