Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SSX2IP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSX2IP Antibody: synthetic peptide directed towards the middle region of human SSX2IP. Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Rabbit Polyclonal Anti-SSX2IP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SSX2IP