Primary Antibodies

View as table Download

Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR