Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ZFYVE20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFYVE20 antibody: synthetic peptide directed towards the N terminal of human ZFYVE20. Synthetic peptide located within the following region: MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKS

Goat Polyclonal Antibody against ZFYVE20

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ELKHTLAKQKGGTD, from the C Terminus of the protein sequence according to NP_071735.

Rabbit polyclonal anti-ZFYVE20 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZFYVE20.