Primary Antibodies

Jump to Filters
View as table Download
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA337635

USD 375.00

5 Days

Rabbit Polyclonal Anti-STAMBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAMBP antibody: synthetic peptide directed towards the N terminal of human STAMBP. Synthetic peptide located within the following region: SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA322496

USD 345.00

In Stock

Anti-STAMBP Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 252-361 amino acids of human STAM binding protein
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA322497

USD 345.00

In Stock

Anti-STAMBP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 252-361 amino acids of human STAM binding protein