Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-VPS37C Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS37C antibody: synthetic peptide directed towards the N terminal of human VPS37C. Synthetic peptide located within the following region: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Rabbit polyclonal antibody to VPS37C (vacuolar protein sorting 37 homolog C (S. cerevisiae))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 46 of VPS37C (Uniprot ID#A5D8V6)

Goat Polyclonal Antibody against VPS37C

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETLKDKTLQELEELQ, from the internal region of the protein sequence according to NP_060436.4.