Primary Antibodies

Jump to Filters
View as table Download
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
R1043

USD 540.00

3 Days

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Immunogen Collagen type VI purified from Human and Bovine placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
R1043B

USD 540.00

3 Days

Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Biotin
Immunogen Collagen type VI purified from Human and Bovine placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
R1043X

USD 1,025.00

3 Days

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Immunogen Collagen type VI purified from Human and Bovine placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
AP31356PU-N

USD 440.00

2 Weeks

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
TA338915

USD 375.00

5 Days

Rabbit Polyclonal Anti-COL6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ