Primary Antibodies

View as table Download

Goat Anti-CTLA + CTLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDFNPKSSKQAKD, from the internal region of the protein sequence according to NP_001824.1; NP_009027.1; NP_001070145.1; NP_001825.1; NP_009028.1.

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLTA antibody: synthetic peptide directed towards the C terminal of human CLTA. Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clta antibody is: synthetic peptide directed towards the C-terminal region of Rat Clta. Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS