Primary Antibodies

Jump to Filters
View as table Download
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA339998

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP1G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA323223

USD 345.00

4 Weeks

Anti-AP1G1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 801-813 amino acids of Human adaptor-related protein complex 1, gamma 1 subunit
gamma Adaptin (AP1G1) Rabbit Polyclonal Antibody
TA323388

USD 345.00

In Stock

Anti-AP1G1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 802-814 amino acids of Human Adapter-related protein complex 1 subunit gamma-1