Rabbit polyclonal anti-Perilipin A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
Rabbit polyclonal anti-Perilipin A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
Rabbit Polyclonal Anti-PLIN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
Goat Polyclonal Antibody against PLIN
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2. |
Goat Polyclonal Antibody against PLIN (C-terminal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2. |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |