Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome c-type Heme Lyase antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCHL.

Rabbit Polyclonal Anti-HCCS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCCS antibody: synthetic peptide directed towards the C terminal of human HCCS. Synthetic peptide located within the following region: PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL