Primary Antibodies

View as table Download

Rabbit polyclonal anti-MRPL13 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRPL13.

Rabbit Polyclonal Anti-MRPL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRPL13 antibody: synthetic peptide directed towards the middle region of human MRPL13. Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD