Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EXOC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EXOC4 Antibody: synthetic peptide directed towards the N terminal of human EXOC4. Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Rabbit Polyclonal Anti-EXOC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EXOC4 Antibody: synthetic peptide directed towards the N terminal of human EXOC4. Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE