Primary Antibodies

View as table Download

Rabbit anti-MIF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MIF

MIF (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human MIF

Rabbit polyclonal anti-macrophage migration inhibitory factor (MIF) antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 67 of human MIF

Goat Polyclonal Antibody against MIF

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAANVGWNNSTFA, from the C Terminus of the protein sequence according to NP_002406.1.

Rabbit Polyclonal Anti-MIF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL