Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Anti-GPR142 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DMWRDTDSPRTLD, from the internal region of the protein sequence according to NP_861455.1. |
Rabbit Polyclonal Anti-GPR142 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR142 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR142. Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH |
GPR142 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR142 |
GPR142 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GPR142 (NP_861455.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPR142
Reactivities
- Human
Isotypes
- IgG