Primary Antibodies

View as table Download

Rabbit polyclonal IGFBP2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2.

Rabbit polyclonal anti-IBP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human IGFBP2.

Rabbit Polyclonal Anti-IGFBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ

Rabbit Polyclonal Anti-IGFBP2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC

IGFBP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IGFBP2

IGFBP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP2 (NP_000588.2).
Modifications Unmodified