Primary Antibodies

Jump to Filters
View as table Download
VAT1 Rabbit Polyclonal Antibody
TA383200

USD 275.00

3 Weeks

VAT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human VAT1.
VAT1 Rabbit Polyclonal Antibody
TA340105

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAT1 antibody: synthetic peptide directed towards the N terminal of human VAT1. Synthetic peptide located within the following region: PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA