WBP11 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human WBP11 (NP_057396.1). |
| Modifications | Unmodified |
WBP11 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human WBP11 (NP_057396.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-WBP11 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP11 antibody: synthetic peptide directed towards the N terminal of human WBP11. Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK |
Anti-WBP11 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 191-210 amino acids of human WW domain binding protein 11 |
Germany
Japan
United Kingdom
China
