Primary Antibodies

Jump to Filters
View as table Download
BLMH Rabbit Polyclonal Antibody
TA335146

USD 375.00

5 Days

Rabbit polyclonal Anti-Blmh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Blmh antibody is: synthetic peptide directed towards the C-terminal region of Mouse Blmh. Synthetic peptide located within the following region: GPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGG
BLMH Rabbit Polyclonal Antibody
TA374017

USD 220.00

3 Weeks

BLMH Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human BLMH (NP_000377.1).
Modifications Unmodified