Rabbit Polyclonal Anti-Cpa2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cpa2 antibody is: synthetic peptide directed towards the middle region of Rat Cpa2. Synthetic peptide located within the following region: GPGASSSPCSDSYHGPKPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLL |
Rabbit polyclonal anti-Carboxypeptidase A2 (CPA2) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 194 of mouse Carboxypeptidase A2 |
Rabbit Polyclonal Anti-CPA2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPA2 |
CPA2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPA2 |
CPA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-419 of human CPA2 (NP_001860.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China