Rabbit Polyclonal Anti-ApoA4 Antibody
Applications | WB |
Reactivities | Chicken, Human |
Conjugation | Unconjugated |
Immunogen | ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4. |
Rabbit Polyclonal Anti-ApoA4 Antibody
Applications | WB |
Reactivities | Chicken, Human |
Conjugation | Unconjugated |
Immunogen | ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4. |
Goat Polyclonal Antibody against APOA4
Applications | WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-KEKESQDKTLSLP, from the internal region (near the C Terminus) of the protein sequence according to NP_000473.2. |
Rabbit Polyclonal ApoA4 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | ApoA4 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ApoA4. |
Rabbit Polyclonal Anti-APOA4 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-APOA4 Antibody: synthetic peptide directed towards the C terminal of human APOA4. Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ |
Rabbit Polyclonal Anti-APOA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APOA4 |
APOA4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2). |
Modifications | Unmodified |