KLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KLF2 |
KLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KLF2 |
KLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KLF2 |
Rabbit Polyclonal Anti-Klf2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Klf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM |
Rabbit Polyclonal Anti-KLF2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP |
Rabbit Polyclonal Anti-KLF2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: NWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRH |
KLF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KLF2 |
KLF2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KLF2 |
KLF2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KLF2 (NP_057354.1). |
Modifications | Unmodified |