Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LDLR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA

LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

LDLR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LDLR

LDL Receptor (LDLR) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human LDL Receptor (LDLR) (NP_000518.1).
Modifications Unmodified