Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-POLM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLM antibody: synthetic peptide directed towards the middle region of human POLM. Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

DNA Polymerase mu Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from DNA Pol μ . at AA range: 210-290