Primary Antibodies

Jump to Filters
View as table Download
SIRT7 Rabbit Polyclonal Antibody
TA326876

USD 275.00

3 Weeks

Rabbit anti-SIRT7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIRT7
SIRT7 Rabbit Polyclonal Antibody
TA330288

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIRT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the middle region of human SIRT7. Synthetic peptide located within the following region: GEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKV
SIRT7 Rabbit Polyclonal Antibody
TA330289

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIRT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the C terminal of human SIRT7. Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE
SIRT7 Rabbit Polyclonal Antibody
TA321852

USD 345.00

In Stock

Anti-SIRT7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-331 amino acids of human sirtuin 7