Rabbit Polyclonal Anti-BIVM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK |
Rabbit Polyclonal Anti-BIVM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: LYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEAT |
Rabbit polyclonal antibody to BIVM (basic, immunoglobulin-like variable motif containing)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 439 and 503 of BIVM (Uniprot ID#Q86UB2) |
Rabbit polyclonal anti-BIVM antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | BIVM peptide corresponding to a region near carboxy terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). Sequence information: C-R-N-S-G-Y-Q-G-Y-S-D-Y-D-G-N-D |
Germany
Japan
United Kingdom
China
