Primary Antibodies

View as table Download

Rabbit monoclonal antibody against DLC8 (N-term) (EP1660Y )

Applications IF, IHC, IP, WB
Reactivities Mouse, Rat, Human, Fruit fly (Drosophila melanogaster)
Conjugation Unconjugated

Rabbit anti-DYNLL1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DYNLL1

Rabbit Polyclonal Anti-DYNLL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1. Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL

Rabbit Polyclonal Anti-DYNLL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the N terminal of human DYNLL1. Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Rabbit Polyclonal Anti-DYNLL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DYNLL1

DYNLL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DYNLL1

DYNLL1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1).
Modifications Unmodified

DYNLL1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human DYNLL1