Primary Antibodies

View as table Download

Rabbit anti-FOXP2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FOXP2

Rabbit Polyclonal Anti-FOXP2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP2 Antibody: Peptide sequence around aa.707~711(E-E-P-L-S) derived from Human FOXP2.

Goat Polyclonal Antibody against FOXP2

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-REIEEEPLSEDLE, from the C Terminus of the protein sequence according to NP_055306.1; NP_683696.2; NP_683697.1.

Rabbit polyclonal FOXP2 Antibody (C-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This FOXP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 657-684 amino acids from the C-terminal region of human FOXP2.

Rabbit Polyclonal Anti-FOXP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA

Rabbit Polyclonal Anti-FOXP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA

Goat Polyclonal Antibody against FOXP2 (Internal region)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1.

Rabbit anti FOXP2 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal region of human FOXP2 protein. This sequence is identical to human, mouse, rat and dog.

Anti-FOXP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 701-715 amino acids of Human forkhead box P2

FOXP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXP2