Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GAMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Rabbit Polyclonal anti-GAMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

GAMT Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of human GAMT (NP_000147.1).
Modifications Unmodified