Primary Antibodies

View as table Download

Rabbit Anti-NMDA NR2A Subunit, N-terminus Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region of the NR2A subunit conjugated to KLH

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

Rabbit Anti-NMDA NR2A Subunit (Tyr1325) Antibody (Phospho-Specific)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Tyr1325 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A

GRIN2A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A

NMDAR2A Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1130-1400 of human NMDAR2A (NP_000824.1).
Modifications Unmodified

NMDAR2A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human NMDAR2A (NP_000824.1).
Modifications Unmodified

Phospho-NMDAR2A/2B (Tyr1246/Tyr1252) Rabbit polyclonal Antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NMDAR2A/B around the phosphorylation site of Tyr1246/1252. AA range:1216-1265 (Phosphorylated)

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A