Rabbit Polyclonal Anti-GSTK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the N terminal of human GSTK1. Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK |
Rabbit Polyclonal Anti-GSTK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the middle region of human GSTK1. Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL |
GSTK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GSTK1 |
GSTK1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-226 of human GSTK1 (NP_057001.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
