Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCTD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL

Rabbit Polyclonal Anti-KCTD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH