Rabbit polyclonal Anti-MED19 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED19 antibody is: synthetic peptide directed towards the middle region of Human MED19. Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH |
Rabbit polyclonal Anti-Med19 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Med19 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID |
MED19 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human MED19 (NP_703151.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
