Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM

NNT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 881-1086 of human NNT (NP_036475.3).
Modifications Unmodified