Rabbit Polyclonal Anti-NOSIP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOSIP antibody: synthetic peptide directed towards the middle region of human NOSIP. Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ |
Rabbit Polyclonal Anti-NOSIP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOSIP antibody: synthetic peptide directed towards the N terminal of human NOSIP. Synthetic peptide located within the following region: LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ |
Rabbit polyclonal antibody to NOSIP (nitric oxide synthase interacting protein)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 90 and 184 of NOSIP (Uniprot ID#Q9Y314) |
NOSIP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
NOSIP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-301 of human NOSIP (NP_057037.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
