Rabbit polyclonal anti-OR6K2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR6K2. |
Rabbit polyclonal anti-OR6K2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR6K2. |
Rabbit Polyclonal Anti-OR6K2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR6K2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6K2. Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI |