Rabbit Polyclonal Anti-OSGEP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the middle region of human OSGEP. Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE |
Rabbit Polyclonal Anti-OSGEP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the N terminal of human OSGEP. Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA |
OSGEP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human OSGEP (NP_060277.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
