Phosphodiesterase 6a / PDE6A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PDE6A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE6A / PDE6 Alpha. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Dog, Panda, Rabbit (94%); Bovine, Bat, Elephant (89%); Horse, Opossum (83%). |
Rabbit polyclonal Anti-PDE6A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE6A antibody is: synthetic peptide directed towards the N-terminal region of Human PDE6A. Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK |
PDE6A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 656-860 of human PDE6A (NP_000431.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China