Primary Antibodies

View as table Download

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.

Rabbit Polyclonal PEN2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2.

Rabbit Polyclonal Anti-PSENEN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT

PEN2/PSENEN Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1).
Modifications Unmodified

PEN2/PSENEN Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1).
Modifications Unmodified