Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Pygm Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pygm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI

Rabbit Polyclonal Anti-PYGM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGM

PYGM rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGM

PYGM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PYGM (NP_005600.1).
Modifications Unmodified