Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SPINT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPINT1 Antibody: synthetic peptide directed towards the middle region of human SPINT1. Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS

Anti-SPINT1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 36-140 amino acids of human serine peptidase inhibitor, Kunitz type 1

SPINT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 234-513 of human SPINT1 (NP_003701.1).
Modifications Unmodified