SRPR beta (SRPRB) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Canine, Chicken |
Immunogen | Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit |
SRPR beta (SRPRB) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Canine, Chicken |
Immunogen | Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the C terminal of human SRPRB. Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI |
Rabbit Polyclonal Anti-SRPRB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
SRPRB Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3). |
Modifications | Unmodified |