Primary Antibodies

Jump to Filters
View as table Download
SSX2IP Rabbit Polyclonal Antibody
TA335636

USD 375.00

5 Days

Rabbit Polyclonal Anti-SSX2IP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSX2IP Antibody: synthetic peptide directed towards the middle region of human SSX2IP. Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
SSX2IP Rabbit Polyclonal Antibody
TA350451

USD 345.00

In Stock

Rabbit Polyclonal Anti-SSX2IP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SSX2IP
SSX2IP Rabbit Polyclonal Antibody
TA369373

USD 380.00

4 Weeks

SSX2IP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SSX2IP