Primary Antibodies

Jump to Filters
View as table Download
TRBP (TARBP2) Rabbit Polyclonal Antibody
TA345870

USD 410.00

5 Days

Rabbit Polyclonal Anti-TARBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARBP2 antibody: synthetic peptide directed towards the N terminal of human TARBP2. Synthetic peptide located within the following region: ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT
TRBP (TARBP2) Rabbit Polyclonal Antibody
TA337046

USD 402.00

5 Days

Rabbit Polyclonal TRBP Antibody

Applications IHC, WB
Reactivities Human, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 340-390 of human TRBP was used as the immunogen.
TRBP (TARBP2) Rabbit Polyclonal Antibody
TA382304

USD 220.00

3 Weeks

TARBP2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-366 of human TARBP2 (NP_599150.1).
Modifications Unmodified