Primary Antibodies

Jump to Filters
View as table Download
Upp2 Rabbit Polyclonal Antibody
TA330993

USD 375.00

5 Days

Rabbit polyclonal Anti-Upp2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Upp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG
UPP2 Rabbit Polyclonal Antibody
TA351904

USD 345.00

In Stock

Rabbit Polyclonal Anti-UPP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2
UPP2 Rabbit Polyclonal Antibody
TA367356

USD 380.00

4 Weeks

UPP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2