Primary Antibodies

View as table Download

Rabbit polyclonal anti-USP13 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP13.

Rabbit Polyclonal Anti-USP13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP13 antibody: synthetic peptide directed towards the N terminal of human USP13. Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK

USP13 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).
Modifications Unmodified

USP13 Rabbit polyclonal Antibody

Applications FC, IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human USP13